PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00032477-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 405aa    MW: 44100.1 Da    PI: 5.0634
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00032477-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-17106150147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg  ++ E++l++d++ qlG++ W++Ia++++ gRt++++k++w+++
  PSME_00032477-RA 106 RGVLSESEEQLIIDLHSQLGNR-WSKIAAHLP-GRTDNEIKNYWNTH 150
                       677899****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.27576100IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.8E-58699IPR009057Homeodomain-like
SuperFamilySSF466899.41E-2187160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-25100156IPR009057Homeodomain-like
PROSITE profilePS5129426.846101155IPR017930Myb domain
SMARTSM007171.5E-16105153IPR001005SANT/Myb domain
PfamPF002491.9E-15106150IPR001005SANT/Myb domain
CDDcd001673.45E-13110151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MRGRGQGQGQ GQGRSVEGKG NVLGAGQRAE PSTPSSLLTV SQSPDISTAY SDNISPLFLR  60
CSVHVASVGC TRGREARRLE NAGRLLRCGK SCRLRWTNYL RPDLKRGVLS ESEEQLIIDL  120
HSQLGNRWSK IAAHLPGRTD NEIKNYWNTH IKKKLKRMGI DPVTHRPIID QTESKPSIAA  180
LNEATEELSG SSPTKKAILQ AVAEVSCRSN ESEITEEAEK SIDSVKAVKH EAAQLATGYG  240
FDSNPTLFDE RSSTIYLCDL PVAETPNLDN SGLDFVGNTV LRGASDDQSL LEFAEDMVPG  300
IISGPLKSQE GLNDELALIN PCSSFNVPIE TSTSNSADQE LQWPNDVSNA APPANNYDIL  360
LGGPASIPET DMQLWHIEHL QSAFDAGWDI HHSANNAIFS NPLFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-208715540108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1067110.0BT106711.1 Picea glauca clone GQ03008_L22 mRNA sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.12e-50myb domain protein 20